PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004511968.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family G2-like
Protein Properties Length: 361aa    MW: 39893.8 Da    PI: 7.2074
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004511968.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.36.4e-32222277156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W++eLH+rFv+a++qLGG++ AtPk+i+e m+v+gLt+++vkSHLQkYRl+
  XP_004511968.1 222 KQRRCWSSELHRRFVDALQQLGGAHAATPKQIREKMQVDGLTNDEVKSHLQKYRLH 277
                     79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.183219279IPR017930Myb domain
SuperFamilySSF466895.2E-17220280IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-28220280IPR009057Homeodomain-like
TIGRFAMsTIGR015574.5E-27222277IPR006447Myb domain, plants
PfamPF002493.0E-7224275IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010092Biological Processspecification of organ identity
GO:0010629Biological Processnegative regulation of gene expression
GO:0048449Biological Processfloral organ formation
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MVVETKPHFQ TIKNIMELNL DLTLSSVPKT VSFFLNGVSQ TKDISHKLSM LDDLIQRFEE  60
ELKKVVAFKR ELPLCILLVN DAIVRLKEEK VRLMGIKDLN YEGNENGNGK GSLTVVKENC  120
DDNKKNWLSS FQLWNTEKKS KNEDDNDKSN GEGVFGGFNG NSCVSSKGAT QVPSFSLVST  180
PVSEVSNGNF KSGGGGGGSS ASSLLQNNQP QPPQPLQQNP RKQRRCWSSE LHRRFVDALQ  240
QLGGAHAATP KQIREKMQVD GLTNDEVKSH LQKYRLHVRR FPISSIEEAN KLALYMAQDQ  300
CGGDISNSKG SLSESVSPQG PLTPLLIGGS VARNSVDAED EQSDCRNWKS EIQHEADNHS  360
L
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00475DAPTransfer from AT4G37180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004511968.10.0PREDICTED: uncharacterized protein LOC101504567 isoform X1
TrEMBLG7K8321e-134G7K832_MEDTR; Myb-like DNA-binding domain, shaqkyf class protein
STRINGGLYMA01G39040.11e-116(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.12e-49G2-like family protein